PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676760650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family bZIP
Protein Properties Length: 326aa    MW: 35920.8 Da    PI: 5.2402
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676760650genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.31.8e-09139188554
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   + 
  676760650 139 KRAKRILANRQSAARSKERKARYIQELERKVQSLQTEATTLSAQLTLFQR 188
                9****************************************998876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-16135199IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909137200IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-10139190No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-8139184No hitNo description
PfamPF001703.0E-8139187IPR004827Basic-leucine zipper domain
CDDcd147037.53E-23140189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEKSDPPQKP GLIPSDPNAD PTPSSFHRRS RSDDMSMFMF MDPLLSSSGA PPSSDELPSD  60
DDLFSSFIDV DSLSSNPHPP VSSSFNSNPP PASSSASRPR HRHSNSVDAG CAMYANEIMD  120
AKKAMPPEKL SELWNVDPKR AKRILANRQS AARSKERKAR YIQELERKVQ SLQTEATTLS  180
AQLTLFQRDT NGLANENTEL KLRLQAMEQQ AQLRNALNEA LRKEVERMKL ETGEISGNSD  240
SFDMGMQQIQ YSPSTLMAIP PYHASFNGQD NMNMHGFNPI DMSNSQSVSE FLQNGRLQGL  300
EISSNSSSLV KSEGPSLSAS ESSSAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417873.11e-176hypothetical protein EUTSA_v10008146mg
SwissprotQ6S4P41e-81RF2B_ORYSJ; Transcription factor RF2b
TrEMBLV4MVL21e-176V4MVL2_EUTSA; Uncharacterized protein
STRINGBra030663.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-128basic leucine-zipper 52